DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Az and LOC1279926

DIOPT Version :10

Sequence 1:NP_648031.1 Gene:Cpr65Az / 38712 FlyBaseID:FBgn0035686 Length:239 Species:Drosophila melanogaster
Sequence 2:XP_061510113.1 Gene:LOC1279926 / 1279926 VectorBaseID:AGAMI1_011969 Length:189 Species:Anopheles gambiae


Alignment Length:71 Identity:15/71 - (21%)
Similarity:30/71 - (42%) Gaps:7/71 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 IIKLESKVNTDGSYMYEYETGNGIKAEEMGYLKNAGVEGAEAQTAEGSFSYTSPEGQEISLTYIA 180
            ::|.| :.:....|.:.|:..:.:..:     .....|..:....:|.:|...|:|...::.|.|
Mosquito    29 LVKTE-EYDAHPQYSFSYDVQDSLTGD-----NKQQHETRDGDVVQGQYSLVEPDGTRRTVDYTA 87

  Fly   181 DE-NGF 185
            |. |||
Mosquito    88 DPVNGF 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AzNP_648031.1 Chitin_bind_4 129..185 CDD:459790 11/56 (20%)
LOC1279926XP_061510113.1 None

Return to query results.
Submit another query.