DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Az and CPR110

DIOPT Version :9

Sequence 1:NP_648031.1 Gene:Cpr65Az / 38712 FlyBaseID:FBgn0035686 Length:239 Species:Drosophila melanogaster
Sequence 2:XP_319711.4 Gene:CPR110 / 1279926 VectorBaseID:AGAP008960 Length:188 Species:Anopheles gambiae


Alignment Length:71 Identity:15/71 - (21%)
Similarity:30/71 - (42%) Gaps:7/71 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 IIKLESKVNTDGSYMYEYETGNGIKAEEMGYLKNAGVEGAEAQTAEGSFSYTSPEGQEISLTYIA 180
            ::|.| :.:....|.:.|:..:.:..:     .....|..:....:|.:|...|:|...::.|.|
Mosquito    28 LVKTE-EYDAHPQYSFSYDVQDSLTGD-----NKQQHETRDGDVVQGQYSLVEPDGTRRTVDYTA 86

  Fly   181 DE-NGF 185
            |. |||
Mosquito    87 DPVNGF 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AzNP_648031.1 Chitin_bind_4 129..185 CDD:278791 11/56 (20%)
CPR110XP_319711.4 Chitin_bind_4 40..92 CDD:278791 11/56 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.