powered by:
Protein Alignment Cpr65Az and CPR110
DIOPT Version :9
Sequence 1: | NP_648031.1 |
Gene: | Cpr65Az / 38712 |
FlyBaseID: | FBgn0035686 |
Length: | 239 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_319711.4 |
Gene: | CPR110 / 1279926 |
VectorBaseID: | AGAP008960 |
Length: | 188 |
Species: | Anopheles gambiae |
Alignment Length: | 71 |
Identity: | 15/71 - (21%) |
Similarity: | 30/71 - (42%) |
Gaps: | 7/71 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 116 IIKLESKVNTDGSYMYEYETGNGIKAEEMGYLKNAGVEGAEAQTAEGSFSYTSPEGQEISLTYIA 180
::|.| :.:....|.:.|:..:.:..: .....|..:....:|.:|...|:|...::.|.|
Mosquito 28 LVKTE-EYDAHPQYSFSYDVQDSLTGD-----NKQQHETRDGDVVQGQYSLVEPDGTRRTVDYTA 86
Fly 181 DE-NGF 185
|. |||
Mosquito 87 DPVNGF 92
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.