DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Az and CPR81

DIOPT Version :9

Sequence 1:NP_648031.1 Gene:Cpr65Az / 38712 FlyBaseID:FBgn0035686 Length:239 Species:Drosophila melanogaster
Sequence 2:XP_318999.3 Gene:CPR81 / 1279298 VectorBaseID:AGAP009879 Length:131 Species:Anopheles gambiae


Alignment Length:92 Identity:44/92 - (47%)
Similarity:61/92 - (66%) Gaps:1/92 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 GAGGGGGEDIPIIKLESKVNTDGSYMYEYETGNGIKAEEMGYLKNAGVEGAEAQTAEGSFSYTSP 169
            |..||......|:....:.|.||||:|.|||.|||:|::.|:|||.|..| |||..:||:|||.|
Mosquito    30 GVYGGPEASAVILNQVYEPNPDGSYVYSYETSNGIRADQRGFLKNPGTPG-EAQVMQGSYSYTGP 93

  Fly   170 EGQEISLTYIADENGFQPQGDHLPTPP 196
            :|...::.|||||||::.:|.|:|:.|
Mosquito    94 DGVVYTINYIADENGYRAEGAHIPSAP 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AzNP_648031.1 Chitin_bind_4 129..185 CDD:278791 31/55 (56%)
CPR81XP_318999.3 Chitin_bind_4 54..109 CDD:278791 31/55 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.