DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Az and CPR79

DIOPT Version :9

Sequence 1:NP_648031.1 Gene:Cpr65Az / 38712 FlyBaseID:FBgn0035686 Length:239 Species:Drosophila melanogaster
Sequence 2:XP_318997.5 Gene:CPR79 / 1279296 VectorBaseID:AGAP009877 Length:386 Species:Anopheles gambiae


Alignment Length:243 Identity:102/243 - (41%)
Similarity:121/243 - (49%) Gaps:48/243 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 AGYPSARPPATYLPVKPPAP--------PPRPPPPAPANSYGPPKKGNGKPPPAPPKPSYGPPPK 78
            ||:..|.|.|.....:...|        ..||..||||  ||||..|.|.          |.|..
Mosquito    81 AGFGGAGPSAGGFGGQAQRPGGVGGGPAAGRPGTPAPA--YGPPSSGFGG----------GAPSS 133

  Fly    79 NGNGKPPPSNAYLPPGNGNGGSSGGGGAGGGGGEDIPIIKLESKVNTDGSYMYEYETGNGIKAEE 143
            .|.|...||..:...|:|.||.:.|....|.....|.||..|:..|.||:|.|.|||.||||.:|
Mosquito   134 FGGGSGAPSGGFSSGGSGFGGGAPGAAPAGPSQPPIEIISYENMNNGDGTYKYSYETANGIKVQE 198

  Fly   144 MGYLKNAGVEGAEAQTAEGSFSYTSPEGQEISLTYIADENGFQPQGDHLPTPPPIPIEIQEALDK 208
            .|.:||.|.:. |..:.:||:|||:|:||.|::|||||||||||||||||||||||.|||:.||.
Mosquito   199 QGEIKNKGSDN-EIPSVQGSYSYTAPDGQVITVTYIADENGFQPQGDHLPTPPPIPAEIQKGLDA 262

  Fly   209 L----AAGGGCHGCDDNETGGNDDGGG------------------GGY 234
            :    ||||...|     .||..|.||                  |||
Mosquito   263 IAAAQAAGGSAGG-----PGGPSDAGGYPGAGKPSQGYPGSVTGSGGY 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AzNP_648031.1 Chitin_bind_4 129..185 CDD:278791 31/55 (56%)
CPR79XP_318997.5 Chitin_bind_4 184..239 CDD:278791 31/55 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27577
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.