DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Az and CPR75

DIOPT Version :9

Sequence 1:NP_648031.1 Gene:Cpr65Az / 38712 FlyBaseID:FBgn0035686 Length:239 Species:Drosophila melanogaster
Sequence 2:XP_318989.4 Gene:CPR75 / 1279290 VectorBaseID:AGAP009871 Length:134 Species:Anopheles gambiae


Alignment Length:98 Identity:51/98 - (52%)
Similarity:69/98 - (70%) Gaps:2/98 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 IIKLESKVNTDGSYMYEYETGNGIKAEEMGYLKNA-GVEGAEAQTAEGSFSYTSPEGQEISLTYI 179
            |::.::.:..||.|.|.|||.|||:.:|.|.||.| ..:.::...|.||.:||:|:||.:.|:|.
Mosquito    28 ILQQDNNIEPDGQYQYSYETANGIRGQETGTLKRANSPDTSDVIVAAGSITYTAPDGQVVELSYT 92

  Fly   180 A-DENGFQPQGDHLPTPPPIPIEIQEALDKLAA 211
            | |||||||.|.|||||||||.:||:|||.||:
Mosquito    93 ADDENGFQPAGAHLPTPPPIPPQIQKALDYLAS 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AzNP_648031.1 Chitin_bind_4 129..185 CDD:278791 27/57 (47%)
CPR75XP_318989.4 Chitin_bind_4 41..99 CDD:278791 27/57 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.