DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Az and CPR33

DIOPT Version :9

Sequence 1:NP_648031.1 Gene:Cpr65Az / 38712 FlyBaseID:FBgn0035686 Length:239 Species:Drosophila melanogaster
Sequence 2:XP_316046.2 Gene:CPR33 / 1276676 VectorBaseID:AGAP006013 Length:147 Species:Anopheles gambiae


Alignment Length:106 Identity:53/106 - (50%)
Similarity:70/106 - (66%) Gaps:0/106 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 GEDIPIIKLESKVNTDGSYMYEYETGNGIKAEEMGYLKNAGVEGAEAQTAEGSFSYTSPEGQEIS 175
            |..|.|:..||....||||.:.||:.|||.|:|.|::||.|.:..|.|.|.||||||.|.|..:|
Mosquito    26 GAPIKIVHSESYHGHDGSYKFGYESANGIAAQEQGFVKNGGSKDHEVQVAHGSFSYTDPHGHPVS 90

  Fly   176 LTYIADENGFQPQGDHLPTPPPIPIEIQEALDKLAAGGGCH 216
            |:|:|||:|||.:|.|:|||||:|.|:.:|..|.|:....|
Mosquito    91 LSYVADEHGFQAKGSHIPTPPPVPQELVDAYAKAASQPAHH 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AzNP_648031.1 Chitin_bind_4 129..185 CDD:278791 29/55 (53%)
CPR33XP_316046.2 Chitin_bind_4 44..100 CDD:278791 29/55 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D130767at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10380
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.