DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Az and CPR32

DIOPT Version :9

Sequence 1:NP_648031.1 Gene:Cpr65Az / 38712 FlyBaseID:FBgn0035686 Length:239 Species:Drosophila melanogaster
Sequence 2:XP_316045.2 Gene:CPR32 / 1276675 VectorBaseID:AGAP006012 Length:156 Species:Anopheles gambiae


Alignment Length:111 Identity:58/111 - (52%)
Similarity:77/111 - (69%) Gaps:2/111 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 EDIPIIKLESKVNTDGSYMYEYETGNGIKAEEMGYLKNAGVEGAEAQTAEGSFSYTSPEGQEISL 176
            :.|||:..||..:.||||.:.||:||||.|:|.|::||||.:..|.|.|.||:|||.|.|..:||
Mosquito    35 KQIPIVHSESYSSHDGSYKFAYESGNGITAQEEGFVKNAGSKDHEVQVAHGSYSYTDPHGVPVSL 99

  Fly   177 TYIADENGFQPQGDHLPTPPPIPIEIQEALDKLAAGGGCHGCDDNE 222
            :|:|||||||.||.|:|||||:|.|:.:|..|.|:....|  |:.|
Mosquito   100 SYVADENGFQVQGSHVPTPPPVPKELVDAYAKAASQPQSH--DEPE 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AzNP_648031.1 Chitin_bind_4 129..185 CDD:278791 31/55 (56%)
CPR32XP_316045.2 Chitin_bind_4 52..108 CDD:278791 31/55 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10380
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.