DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Az and CPR15

DIOPT Version :9

Sequence 1:NP_648031.1 Gene:Cpr65Az / 38712 FlyBaseID:FBgn0035686 Length:239 Species:Drosophila melanogaster
Sequence 2:XP_315459.4 Gene:CPR15 / 1276149 VectorBaseID:AGAP005456 Length:137 Species:Anopheles gambiae


Alignment Length:96 Identity:44/96 - (45%)
Similarity:63/96 - (65%) Gaps:9/96 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 IIKLESKVNTDGSYMYEYETGNGIKAEEMGYLKNAGVEGAEAQTAEGSFSYTSPEGQEISLTYIA 180
            ::..:|.||.||||.|.|||.||:.|:|      :||.|   |:|:||:|||..:|.:..::|:|
Mosquito    26 VLASDSVVNPDGSYNYRYETSNGLAAQE------SGVGG---QSAQGSYSYTGDDGVQYQVSYVA 81

  Fly   181 DENGFQPQGDHLPTPPPIPIEIQEALDKLAA 211
            |||||||||.|||...|.|..:.:.|:::.|
Mosquito    82 DENGFQPQGAHLPVDGPAPDHVLKTLEQIRA 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AzNP_648031.1 Chitin_bind_4 129..185 CDD:278791 25/55 (45%)
CPR15XP_315459.4 Chitin_bind_4 39..86 CDD:278791 25/55 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.