DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Az and CPR113

DIOPT Version :9

Sequence 1:NP_648031.1 Gene:Cpr65Az / 38712 FlyBaseID:FBgn0035686 Length:239 Species:Drosophila melanogaster
Sequence 2:XP_309807.4 Gene:CPR113 / 1271062 VectorBaseID:AGAP010887 Length:322 Species:Anopheles gambiae


Alignment Length:207 Identity:81/207 - (39%)
Similarity:108/207 - (52%) Gaps:9/207 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LICIAIGYVRSQPAG--YPSARPPATYLPVKPPAPPPRPPPPAPANSYGPPK-KGNGKPPPAPPK 70
            |:|..:|...:....  |.:..|.|::............|..:|||.|.||. :|....|...|.
Mosquito     7 LLCAFLGLASAARLDNLYGAPAPSASFQGGAGDGNLLNAPRQSPANQYLPPSAQGQQGYPSVAPL 71

  Fly    71 PSYGPPPKNGNG-KPPPSNAYLPPGNGNGGSSGGGGAGGGGG----EDIPIIKLESKVNTDGSYM 130
            ...|......|. .|.||.....||:|:..|...||:..|..    ..|||::.|:..|.||||.
Mosquito    72 GQQGQQQSGFNTYNPQPSGPGSYPGSGSAPSGPAGGSFQGTNYQQTTPIPILRYENVNNGDGSYR 136

  Fly   131 YEYETGNGIKAEEMGYLKNAGVEGAEAQTAEGSFSYTSPEGQEISLTYIADENGFQPQGDHLPTP 195
            ::|.|||||:.:|.|:|:|.|.|.:| |...|.:|||:|:||..|:.|.||.|||||.|||||||
Mosquito   137 FDYATGNGIQHQEEGFLRNLGPEKSE-QVVSGGYSYTAPDGQLYSVQYKADANGFQPVGDHLPTP 200

  Fly   196 PPIPIEIQEALD 207
            ||:|..:|||.|
Mosquito   201 PPLPQALQEAYD 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AzNP_648031.1 Chitin_bind_4 129..185 CDD:278791 27/55 (49%)
CPR113XP_309807.4 Chitin_bind_4 135..190 CDD:278791 27/55 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 133 1.000 Inparanoid score I6998
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10380
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.070

Return to query results.
Submit another query.