DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Az and CPR152

DIOPT Version :9

Sequence 1:NP_648031.1 Gene:Cpr65Az / 38712 FlyBaseID:FBgn0035686 Length:239 Species:Drosophila melanogaster
Sequence 2:XP_024667073.1 Gene:CPR152 / 1270916 VectorBaseID:AGAP012487 Length:317 Species:Anopheles gambiae


Alignment Length:228 Identity:49/228 - (21%)
Similarity:72/228 - (31%) Gaps:74/228 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 PANSYGPPKKGNG-----------KPPPAPPKPSYGPPPKNGNGKPPPSNAYLPPGNGNG----- 98
            |.|||.||..|:|           .....||..|||          .|.::|.||.:.:|     
Mosquito    31 PINSYLPPAHGHGHGGDGGHHEDHHTDLVPPSSSYG----------TPDSSYGPPHHQSGFHPDH 85

  Fly    99 ------GSSGGGGAGGGGGEDIPIIKLESKVNTDGSYMYEYETGNGIKAEEMGYLKNAGVEGAEA 157
                  ..........|..||.|           ..|.:.||..     ||...|.....|..:.
Mosquito    86 DEHEDHHDHHDNHDESGSFEDEP-----------AKYEFSYEVD-----EEHTDLSFGHEEMRDG 134

  Fly   158 QTAEGSFSYTSPEGQEISLTYIADENGFQPQ-----GDHLPTPPPIPIE---------------- 201
            ....|.::...|:|:...:.|.||..|::|:     ||..|.....|.|                
Mosquito   135 DYTTGKYNVLLPDGRRQIVEYEADHKGYRPKITYEGGDEHPHHHEHPHEHAQEHGHGGYSKEAPH 199

  Fly   202 -----IQEALDKLAAGGGCHGCDDNETGGNDDG 229
                 .:|:.......|..||.::.::.|:|:|
Mosquito   200 NQLGYPRESHHDFEHNGITHGSNEYDSHGHDNG 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AzNP_648031.1 Chitin_bind_4 129..185 CDD:278791 13/55 (24%)
CPR152XP_024667073.1 Chitin_bind_4 111..162 CDD:306811 13/55 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.