DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Az and CPR111

DIOPT Version :9

Sequence 1:NP_648031.1 Gene:Cpr65Az / 38712 FlyBaseID:FBgn0035686 Length:239 Species:Drosophila melanogaster
Sequence 2:XP_308831.4 Gene:CPR111 / 1270156 VectorBaseID:AGAP006931 Length:325 Species:Anopheles gambiae


Alignment Length:209 Identity:44/209 - (21%)
Similarity:60/209 - (28%) Gaps:104/209 - (49%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 QPAGYPSARP--PATYLPVKPPAPPPRPPPPAPANSYGPPKKGNGKPPPAPPKPSYGPPPKNGNG 82
            |||.|.:|.|  ||||:....||                                          
Mosquito    29 QPALYAAAAPLAPATYIAAAGPA------------------------------------------ 51

  Fly    83 KPPPSNAYLPPGNGNGGSSGGGGAGGGGGEDIPIIKLESKVNTD---GSYMYEYETGNGIKAEEM 144
                                               :|.|:.:..   |.|.|.|..|...|||..
Mosquito    52 -----------------------------------ELHSQYHAQDELGQYSYGYNGGLSAKAESK 81

  Fly   145 GYLKNAGVEGAEAQTAEGSFSYTSPEGQEISLTYIADE-NGFQPQGDHLPTPP------PIPI-- 200
            .:      :|    ...||:||...|.:..::.|.||. |||:....:||..|      |.|:  
Mosquito    82 SF------DG----ITRGSYSYLDAENKLQTVAYTADALNGFRVAASNLPVAPVETRTAPEPVQD 136

  Fly   201 --EIQEA-LDKLAA 211
              |:..| .|.:||
Mosquito   137 TPEVAAAKADHMAA 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AzNP_648031.1 Chitin_bind_4 129..185 CDD:278791 17/56 (30%)
CPR111XP_308831.4 Chitin_bind_4 66..113 CDD:278791 17/56 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.