DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp65Aa and Lcp65Ag3

DIOPT Version :9

Sequence 1:NP_477282.2 Gene:Acp65Aa / 38710 FlyBaseID:FBgn0020765 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_652662.1 Gene:Lcp65Ag3 / 59159 FlyBaseID:FBgn0086611 Length:105 Species:Drosophila melanogaster


Alignment Length:103 Identity:43/103 - (41%)
Similarity:65/103 - (63%) Gaps:3/103 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MKLMLVVGSIALLLALASARPQNDVEVLEYESENTGLGGYKFSYKLSDGTSRTEEGVVNNAGTDN 66
            ||.::|   ...|.|:|.|.|..:...:.....:.|...:|:.::.|||.:....|.:|:.||:|
  Fly     1 MKFLIV---FVALFAVALAAPAAEEPTIVRSESDVGPESFKYDWETSDGQAAQAVGQLNDIGTEN 62

  Fly    67 ESISIRGSVTWVAPDGQTYTINFVADENGFQPEGAHLP 104
            |:||:.||..::|.|||||.:|::||:|||||||||||
  Fly    63 EAISVSGSYRFIADDGQTYQVNYIADKNGFQPEGAHLP 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp65AaNP_477282.2 Chitin_bind_4 41..96 CDD:278791 24/54 (44%)
Lcp65Ag3NP_652662.1 Chitin_bind_4 37..92 CDD:278791 24/54 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466903
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27015
OrthoDB 1 1.010 - - D130920at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.