DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp65Aa and Cpr65Au

DIOPT Version :9

Sequence 1:NP_477282.2 Gene:Acp65Aa / 38710 FlyBaseID:FBgn0020765 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_001286953.1 Gene:Cpr65Au / 59158 FlyBaseID:FBgn0042119 Length:106 Species:Drosophila melanogaster


Alignment Length:97 Identity:43/97 - (44%)
Similarity:62/97 - (63%) Gaps:3/97 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MLVVGSIALLLALA-SARPQNDVEVLEYESENTGLGGYKFSYKLSDGTSRTEEGVVN-NAGTDNE 67
            |.:|..:|:.:.|| .|......|.::.|||||| ..|.|:|:.|:|.||||.|.|. .||.::.
  Fly     6 MWLVAFLAIGICLAFPAGEDAQAETIKLESENTG-DKYSFAYETSNGISRTETGEVKPGAGEEDG 69

  Fly    68 SISIRGSVTWVAPDGQTYTINFVADENGFQPE 99
            |:|::||.:|.||||:.|.|:|.|||.|:.|:
  Fly    70 SLSVQGSTSWSAPDGKKYEISFTADETGYHPK 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp65AaNP_477282.2 Chitin_bind_4 41..96 CDD:278791 28/55 (51%)
Cpr65AuNP_001286953.1 Chitin_bind_4 42..98 CDD:278791 28/55 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1508073at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.