DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp65Aa and Cpr65Au

DIOPT Version :10

Sequence 1:NP_477282.2 Gene:Acp65Aa / 38710 FlyBaseID:FBgn0020765 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_652661.1 Gene:Cpr65Au / 59158 FlyBaseID:FBgn0042119 Length:106 Species:Drosophila melanogaster


Alignment Length:140 Identity:26/140 - (18%)
Similarity:42/140 - (30%) Gaps:57/140 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PMIDVEDSSGLLENDVDNEMETTNPSWKCSLPHVLVATISSFLFGYHLGVVNEPLESISSDLGFS 86
            |...:|....||:.||         :|.               .|:.:|             ||.
  Fly   124 PWYGIEQEYTLLQKDV---------NWP---------------LGWPIG-------------GFP 151

  Fly    87 GDTLAEGLVVSVCLGGAFLGSLFSGGVADGFGRRRAFQICALPMILGAFVSGVSNSLAVMLLGR- 150
            |..            |.:..|:   |....|||..........:..|..:||::..   ::.|: 
  Fly   152 GPQ------------GPYYCSI---GADKSFGRDIVDAHYKASLYAGINISGINGE---VMPGQW 198

  Fly   151 -FLVGTGMGL 159
             |.||..:|:
  Fly   199 EFQVGPSVGI 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp65AaNP_477282.2 Chitin_bind_4 41..96 CDD:459790 6/54 (11%)
Cpr65AuNP_652661.1 Chitin_bind_4 42..98 CDD:459790
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.