DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp65Aa and Lcp65Ab2

DIOPT Version :9

Sequence 1:NP_477282.2 Gene:Acp65Aa / 38710 FlyBaseID:FBgn0020765 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_788469.1 Gene:Lcp65Ab2 / 48381 FlyBaseID:FBgn0020643 Length:104 Species:Drosophila melanogaster


Alignment Length:112 Identity:49/112 - (43%)
Similarity:66/112 - (58%) Gaps:22/112 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MKLMLVVGSIALLLALASARPQ--------NDVEVLEYESENTGLGGYKFSYKLSDGTSRTEEGV 58
            ||.::|   ...|.|:|.|||.        :|||..::.|:          .:.|||||..:|||
  Fly     1 MKFLIV---FVALFAMAVARPNLAEIVRQVSDVEPEKWSSD----------VETSDGTSIKQEGV 52

  Fly    59 VNNAGTDNESISIRGSVTWV-APDGQTYTINFVADENGFQPEGAHLP 104
            :.|||||||:..:.||.||| ...|:.:||.:||||||:||:|||||
  Fly    53 LKNAGTDNEAAVVHGSFTWVDEKTGEKFTITYVADENGYQPQGAHLP 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp65AaNP_477282.2 Chitin_bind_4 41..96 CDD:278791 28/55 (51%)
Lcp65Ab2NP_788469.1 Chitin_bind_4 40..91 CDD:306811 28/50 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466906
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D130920at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.