DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp65Aa and LOC4576295

DIOPT Version :10

Sequence 1:NP_477282.2 Gene:Acp65Aa / 38710 FlyBaseID:FBgn0020765 Length:105 Species:Drosophila melanogaster
Sequence 2:XP_001237743.3 Gene:LOC4576295 / 4576295 VectorBaseID:AGAMI1_002917 Length:125 Species:Anopheles gambiae


Alignment Length:85 Identity:31/85 - (36%)
Similarity:50/85 - (58%) Gaps:7/85 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLALASARPQNDVEVLEYESENTGLGGYKFSYKLSDGTSRTEEGVVN-NAGTDNESISIRGSVTW 77
            ||.:....|..| :::.|||..|. .||:|||:..||.:|.|.|.:: :.|.    :::.|..::
Mosquito    15 LLPVVIGAPIGD-DLISYESVQTD-NGYRFSYETKDGQAREEVGTIDPSTGV----LTVTGWYSY 73

  Fly    78 VAPDGQTYTINFVADENGFQ 97
            ..|||.|..::|||||||::
Mosquito    74 RTPDGDTQRVDFVADENGYR 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp65AaNP_477282.2 Chitin_bind_4 41..96 CDD:459790 21/55 (38%)
LOC4576295XP_001237743.3 None

Return to query results.
Submit another query.