DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp65Aa and CG15515

DIOPT Version :10

Sequence 1:NP_477282.2 Gene:Acp65Aa / 38710 FlyBaseID:FBgn0020765 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_001263088.1 Gene:CG15515 / 43538 FlyBaseID:FBgn0039719 Length:123 Species:Drosophila melanogaster


Alignment Length:99 Identity:30/99 - (30%)
Similarity:53/99 - (53%) Gaps:4/99 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLMLVVGSIALLLALASARPQNDV---EVLEYESENTGLGGYKFSYKLSDGTSRTEEGVVNNAGT 64
            ||:|....:||:.|.:||...:.|   .|.||.::.....||:|:.:..:|:.|.|.||:.|.||
  Fly     5 KLLLFTALVALMAAHSSAGLLDYVFPTIVSEYYNQAPTKEGYRFASEEPNGSKREEMGVIMNPGT 69

  Fly    65 DNESISIRGSVTWVAPDGQTYTIN-FVADENGFQ 97
            .:|.:.:.|..:.......|.|:. :.||::|::
  Fly    70 PDEQLVVMGMYSSYDEKTDTETVTMYTADKDGYK 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp65AaNP_477282.2 Chitin_bind_4 41..96 CDD:459790 16/55 (29%)
CG15515NP_001263088.1 None

Return to query results.
Submit another query.