DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp65Aa and Ccp84Ac

DIOPT Version :10

Sequence 1:NP_477282.2 Gene:Acp65Aa / 38710 FlyBaseID:FBgn0020765 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_649681.1 Gene:Ccp84Ac / 40823 FlyBaseID:FBgn0004781 Length:217 Species:Drosophila melanogaster


Alignment Length:57 Identity:16/57 - (28%)
Similarity:25/57 - (43%) Gaps:5/57 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 YKFSYKLSDGTSRTEEGVVNNAGTDNESISIRGSVTWVAPDGQTYTINFVADE-NGF 96
            |.|:|.:.|..|...:..|.:...|    .::|..:....||...|:.:.||. |||
  Fly    65 YNFAYDVQDALSGDSKSQVESRDGD----VVQGEYSLDDADGFRRTVKYTADSVNGF 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp65AaNP_477282.2 Chitin_bind_4 41..96 CDD:459790 14/55 (25%)
Ccp84AcNP_649681.1 Chitin_bind_4 65..117 CDD:459790 14/55 (25%)

Return to query results.
Submit another query.