DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp65Aa and Ccp84Ae

DIOPT Version :10

Sequence 1:NP_477282.2 Gene:Acp65Aa / 38710 FlyBaseID:FBgn0020765 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_649679.1 Gene:Ccp84Ae / 40821 FlyBaseID:FBgn0004779 Length:208 Species:Drosophila melanogaster


Alignment Length:57 Identity:18/57 - (31%)
Similarity:26/57 - (45%) Gaps:5/57 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 YKFSYKLSDGTSRTEEGVVNNAGTDNESISIRGSVTWVAPDGQTYTINFVADE-NGF 96
            |.:||.:.|..|...:|.|.....|    .:||..:.:..||...|:.:.||. |||
  Fly    51 YTYSYDVQDTLSGDNKGHVEERDGD----VVRGEYSLIDADGFKRTVTYTADSINGF 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp65AaNP_477282.2 Chitin_bind_4 41..96 CDD:459790 16/55 (29%)
Ccp84AeNP_649679.1 Chitin_bind_4 51..103 CDD:459790 16/55 (29%)

Return to query results.
Submit another query.