DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp65Aa and Ccp84Af

DIOPT Version :10

Sequence 1:NP_477282.2 Gene:Acp65Aa / 38710 FlyBaseID:FBgn0020765 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster


Alignment Length:83 Identity:21/83 - (25%)
Similarity:34/83 - (40%) Gaps:9/83 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LALASARPQNDVEVLEYESENTGLGGYKFSYKLSDGTSRTEEGVVNNAGTDNESISIRGSVTWVA 79
            :|:|.|:|.......||:....    |||:|.:.|..|...:..|.....|    .:.|..:.:.
  Fly    40 VAVAHAQPVLTKATEEYDPHPQ----YKFAYDVQDSLSGDSKSQVEERDGD----VVHGEYSLID 96

  Fly    80 PDGQTYTINFVADE-NGF 96
            .||....:.:.:|. |||
  Fly    97 SDGYKRIVQYTSDPVNGF 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp65AaNP_477282.2 Chitin_bind_4 41..96 CDD:459790 13/55 (24%)
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:459790 13/55 (24%)

Return to query results.
Submit another query.