DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp65Aa and Cpr76Bb

DIOPT Version :10

Sequence 1:NP_477282.2 Gene:Acp65Aa / 38710 FlyBaseID:FBgn0020765 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_649121.1 Gene:Cpr76Bb / 40121 FlyBaseID:FBgn0036879 Length:198 Species:Drosophila melanogaster


Alignment Length:57 Identity:15/57 - (26%)
Similarity:26/57 - (45%) Gaps:5/57 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 YKFSYKLSDGTSRTEEGVVNNAGTDNESISIRGSVTWVAPDGQTYTINFVADE-NGF 96
            |:|.|.:.|..:..::........|    .::||.:....||.|..:.:.||: |||
  Fly    86 YQFDYGVKDAHTGDQKSQWETRDGD----KVKGSYSLKESDGTTRVVEYTADDHNGF 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp65AaNP_477282.2 Chitin_bind_4 41..96 CDD:459790 13/55 (24%)
Cpr76BbNP_649121.1 Chitin_bind_4 86..138 CDD:459790 13/55 (24%)

Return to query results.
Submit another query.