DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp65Aa and Lcp65Aa

DIOPT Version :9

Sequence 1:NP_477282.2 Gene:Acp65Aa / 38710 FlyBaseID:FBgn0020765 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_477280.1 Gene:Lcp65Aa / 38709 FlyBaseID:FBgn0020645 Length:102 Species:Drosophila melanogaster


Alignment Length:103 Identity:38/103 - (36%)
Similarity:65/103 - (63%) Gaps:3/103 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MKLMLVVGSIALLLALASARPQNDVEVLEYESENTGLGGYKFSYKLSDGTSRTEEGVVNNAGTDN 66
            ||.:||:..:...|.||:|.|  |.|:::..|: .....|.:.::.||||.:.:.|.:.:.|.:.
  Fly     1 MKSILVLACLLSALCLAAAAP--DAEIVDLVSD-VNADSYSYKFETSDGTKQEQHGSLKSLGPEE 62

  Fly    67 ESISIRGSVTWVAPDGQTYTINFVADENGFQPEGAHLP 104
            :::.:.||.::|..||||:.|::|||||||||:|..:|
  Fly    63 DALQVAGSFSFVGDDGQTHAISYVADENGFQPQGEDIP 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp65AaNP_477282.2 Chitin_bind_4 41..96 CDD:278791 20/54 (37%)
Lcp65AaNP_477280.1 Chitin_bind_4 37..92 CDD:278791 20/54 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466927
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27015
OrthoDB 1 1.010 - - D130920at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.