DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp65Aa and Lcp65Ag2

DIOPT Version :10

Sequence 1:NP_477282.2 Gene:Acp65Aa / 38710 FlyBaseID:FBgn0020765 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_477272.1 Gene:Lcp65Ag2 / 38702 FlyBaseID:FBgn0020637 Length:105 Species:Drosophila melanogaster


Alignment Length:103 Identity:42/103 - (40%)
Similarity:65/103 - (63%) Gaps:3/103 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MKLMLVVGSIALLLALASARPQNDVEVLEYESENTGLGGYKFSYKLSDGTSRTEEGVVNNAGTDN 66
            ||.::|   ...|.|:|.|.|..:...:.....:.|...:|:.::.|||.:....|.:|:.||:|
  Fly     1 MKFLIV---FVALFAVALAAPAAEEPTIVRSESDVGPESFKYDWETSDGQAAQAVGQLNDIGTEN 62

  Fly    67 ESISIRGSVTWVAPDGQTYTINFVADENGFQPEGAHLP 104
            |:||:.||..::|.|||||.:|::||:|||||:|||||
  Fly    63 EAISVSGSYRFIADDGQTYQVNYIADKNGFQPQGAHLP 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp65AaNP_477282.2 Chitin_bind_4 41..96 CDD:459790 24/54 (44%)
Lcp65Ag2NP_477272.1 Chitin_bind_4 37..92 CDD:459790 24/54 (44%)

Return to query results.
Submit another query.