DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp65Aa and Cpr57A

DIOPT Version :10

Sequence 1:NP_477282.2 Gene:Acp65Aa / 38710 FlyBaseID:FBgn0020765 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_611489.1 Gene:Cpr57A / 37319 FlyBaseID:FBgn0034517 Length:184 Species:Drosophila melanogaster


Alignment Length:104 Identity:34/104 - (32%)
Similarity:49/104 - (47%) Gaps:17/104 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MKLMLVVGSIALLLALASARPQNDVEVLEYESENTGLGGYKFSYKLSDG---TSRTEEGVVNNAG 63
            |.::|||    .|||:|:|    ||..|...........|.|||:....   ..|....|.:.:|
  Fly     1 MFIVLVV----CLLAVAAA----DVSHLVTPEPKVPASPYVFSYQAGRAPGHVDRQHTEVSDGSG 57

  Fly    64 TDNESISIRGSVTWVAPDGQTYTINFVADENGFQPEGAH 102
            .      |||:.::|.|..|..|:.:||||:||.|:.:|
  Fly    58 V------IRGAFSYVDPKNQVRTVQYVADEHGFHPQLSH 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp65AaNP_477282.2 Chitin_bind_4 41..96 CDD:459790 18/57 (32%)
Cpr57ANP_611489.1 Chitin_bind_4 32..84 CDD:459790 18/57 (32%)

Return to query results.
Submit another query.