DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp65Aa and Cpr49Ab

DIOPT Version :10

Sequence 1:NP_477282.2 Gene:Acp65Aa / 38710 FlyBaseID:FBgn0020765 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_610769.1 Gene:Cpr49Ab / 36345 FlyBaseID:FBgn0050042 Length:259 Species:Drosophila melanogaster


Alignment Length:124 Identity:32/124 - (25%)
Similarity:53/124 - (42%) Gaps:30/124 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GSIALLLALASARPQ----------------------------NDVEVLEYESENTGLGGYKFSY 45
            |..|:::...|||||                            |...::..| ::..:.||.:.:
  Fly   114 GGAAVVVPRTSARPQPRPTTAAPPAIADPTANLPKGRGTGEGGNGWAIIRQE-DDVEVDGYHYLW 177

  Fly    46 KLSDGTSRTEEGVVNNAGTDNESISIRGSVTWVAPDGQTYTINFVADENGFQPEGAHLP 104
            :..:|....|.|.:... |:.|.:..:|...:..|||..|.:::|||:|||.|..||||
  Fly   178 ETENGILGEESGRIEKL-TEEEGLRSKGFYEYTGPDGILYRVDYVADDNGFVPSAAHLP 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp65AaNP_477282.2 Chitin_bind_4 41..96 CDD:459790 15/54 (28%)
Cpr49AbNP_610769.1 Chitin_bind_4 173..227 CDD:459790 15/54 (28%)

Return to query results.
Submit another query.