DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp65Aa and Cpr47Ec

DIOPT Version :10

Sequence 1:NP_477282.2 Gene:Acp65Aa / 38710 FlyBaseID:FBgn0020765 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_610657.1 Gene:Cpr47Ec / 36191 FlyBaseID:FBgn0033600 Length:131 Species:Drosophila melanogaster


Alignment Length:95 Identity:32/95 - (33%)
Similarity:53/95 - (55%) Gaps:5/95 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 IALLLALASARP----QNDVEVLEYESENTGLGGYKFSYKLSDGTSRTEEGVVNNAGTDNESISI 71
            :|:::|...|.|    :..|.:|:.|...|. .||..:|..:||.||.||..:.:.|||.|::.:
  Fly    10 LAVMVACGQALPVDPEREPVAILKSEIIKTE-EGYTSAYVGADGISRNEEAFLVDKGTDEEALEV 73

  Fly    72 RGSVTWVAPDGQTYTINFVADENGFQPEGA 101
            :||..::..|||...:.:.|.:|||.|.|:
  Fly    74 KGSYKYINEDGQEVEVFYTAGKNGFVPYGS 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp65AaNP_477282.2 Chitin_bind_4 41..96 CDD:459790 19/54 (35%)
Cpr47EcNP_610657.1 Chitin_bind_4 43..98 CDD:459790 19/54 (35%)

Return to query results.
Submit another query.