DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp65Aa and Lcp2

DIOPT Version :10

Sequence 1:NP_477282.2 Gene:Acp65Aa / 38710 FlyBaseID:FBgn0020765 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_476620.1 Gene:Lcp2 / 35818 FlyBaseID:FBgn0002533 Length:126 Species:Drosophila melanogaster


Alignment Length:106 Identity:30/106 - (28%)
Similarity:55/106 - (51%) Gaps:11/106 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMKLMLVVGSIALLLALASARPQNDV--EVLEYESENTGLGGYKFSYKLSDGTSRTEEGVVNNAG 63
            |.|.::::..:.:..|||.....:||  :||. .|::....|:..|...|:|..:...|..:.  
  Fly     1 MFKFVMILAVVGVATALAPVSRSDDVHADVLS-RSDDVRADGFDSSLHTSNGIEQAASGDAHG-- 62

  Fly    64 TDNESISIRGSVTWVAPDGQTYTINFVADENGFQPEGAHLP 104
                  :|.|:..|::|:|:...:.:||:|||:||.||.:|
  Fly    63 ------NIHGNFGWISPEGEHVEVKYVANENGYQPSGAWIP 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp65AaNP_477282.2 Chitin_bind_4 41..96 CDD:459790 13/54 (24%)
Lcp2NP_476620.1 Chitin_bind_4 42..89 CDD:459790 13/54 (24%)

Return to query results.
Submit another query.