DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp65Aa and LOC3290085

DIOPT Version :10

Sequence 1:NP_477282.2 Gene:Acp65Aa / 38710 FlyBaseID:FBgn0020765 Length:105 Species:Drosophila melanogaster
Sequence 2:XP_556680.3 Gene:LOC3290085 / 3290085 VectorBaseID:AGAMI1_011772 Length:134 Species:Anopheles gambiae


Alignment Length:104 Identity:42/104 - (40%)
Similarity:53/104 - (50%) Gaps:19/104 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 IALLLA---LASARP--QNDVEVLEYE---SENTGLGGYKFSYKLSDGTSRTEEGVVNNAGTDNE 67
            :|.|||   |..|||  :.|.....||   :||    |..||||..|...|.|     ...||.:
Mosquito     9 LAFLLASTLLTDARPAMEKDHNFHYYEIISTEN----GQLFSYKTKDNQWRDE-----TVETDPK 64

  Fly    68 S--ISIRGSVTWVAPDGQTYTINFVADENGFQPEGAHLP 104
            :  :.|.|...:|.|||.||.:.:||||||::|.|.|||
Mosquito    65 TGKLVISGWYRYVGPDGVTYQVKYVADENGYRPLGMHLP 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp65AaNP_477282.2 Chitin_bind_4 41..96 CDD:459790 22/56 (39%)
LOC3290085XP_556680.3 None

Return to query results.
Submit another query.