DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp65Aa and Cpr12A

DIOPT Version :10

Sequence 1:NP_477282.2 Gene:Acp65Aa / 38710 FlyBaseID:FBgn0020765 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_572896.1 Gene:Cpr12A / 32309 FlyBaseID:FBgn0030494 Length:173 Species:Drosophila melanogaster


Alignment Length:113 Identity:28/113 - (24%)
Similarity:51/113 - (45%) Gaps:16/113 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MLVVGSIALLLALASARPQNDVEVLEYESENTGL---------GGYKFSYKLSDGTSRTEEGV-- 58
            |...|||...:.|.||...:..::.|.......|         |.|::.::|.|||:|.|.|.  
  Fly     1 MATSGSILFAIFLLSATLISAQQIKESAPSARLLDRFDNRYPDGSYEYRFELDDGTARYERGYFV 65

  Fly    59 -VNNAGTDNESISIRGSVTWVAPDGQTYTINFVADENGFQPEGAHLPK 105
             :|    |.:::.:.|...:...||:..|:.:.||:.|::...:..|:
  Fly    66 KIN----DVKTLMVVGYYAYRMTDGRYITVFYNADQFGYRQNQSITPQ 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp65AaNP_477282.2 Chitin_bind_4 41..96 CDD:459790 16/57 (28%)
Cpr12ANP_572896.1 Chitin_bind_4 46..100 CDD:459790 16/57 (28%)

Return to query results.
Submit another query.