DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp65Aa and Cpr60D

DIOPT Version :10

Sequence 1:NP_477282.2 Gene:Acp65Aa / 38710 FlyBaseID:FBgn0020765 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_726468.1 Gene:Cpr60D / 246492 FlyBaseID:FBgn0050163 Length:93 Species:Drosophila melanogaster


Alignment Length:103 Identity:28/103 - (27%)
Similarity:45/103 - (43%) Gaps:17/103 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMKLMLVVGSIALLLALASARPQNDVEVLEYESEN----TGLGGYKFSYKLSDGTSRTEEGVVNN 61
            |:|..|:   .||.:.|||. .:.|::....:|||    .|.|.::....:|:|.....:|.|| 
  Fly     1 MLKYSLI---FALFVVLASC-SEEDLQAQLLKSENRQNLDGAGQFQHEITVSNGIQVKAQGNVN- 60

  Fly    62 AGTDNESISIRGSVTWVAPDGQTYTINFVADENGFQPE 99
                    .|:|.......||:...:.:.||..||.|:
  Fly    61 --------GIQGEYFLPGEDGKQIRVTYTADATGFHPK 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp65AaNP_477282.2 Chitin_bind_4 41..96 CDD:459790 11/54 (20%)
Cpr60DNP_726468.1 Chitin_bind_4 41..87 CDD:459790 11/54 (20%)

Return to query results.
Submit another query.