DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp65Aa and LOC1272964

DIOPT Version :10

Sequence 1:NP_477282.2 Gene:Acp65Aa / 38710 FlyBaseID:FBgn0020765 Length:105 Species:Drosophila melanogaster
Sequence 2:XP_311895.4 Gene:LOC1272964 / 1272964 VectorBaseID:AGAMI1_008652 Length:200 Species:Anopheles gambiae


Alignment Length:77 Identity:18/77 - (23%)
Similarity:31/77 - (40%) Gaps:11/77 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ESENTGLGGYKFSYKLSD---GTSRTEEGVVNNAGTDNESISIRGSVTWVAPDGQTYTINFVADE 93
            ||.:.....|.:.|.:.|   |..::::.|.|..       .:||....:..||....:::.||:
Mosquito    82 ESSDYDRDDYSYGYAVRDELSGDIKSQQEVRNGD-------RVRGQYRTLESDGTERIVDYTADD 139

  Fly    94 -NGFQPEGAHLP 104
             .||.....|.|
Mosquito   140 VRGFNAVVRHQP 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp65AaNP_477282.2 Chitin_bind_4 41..96 CDD:459790 12/58 (21%)
LOC1272964XP_311895.4 None

Return to query results.
Submit another query.