DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Aa and Cpr65Ax1

DIOPT Version :9

Sequence 1:NP_477280.1 Gene:Lcp65Aa / 38709 FlyBaseID:FBgn0020645 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_001097523.1 Gene:Cpr65Ax1 / 5740751 FlyBaseID:FBgn0086900 Length:102 Species:Drosophila melanogaster


Alignment Length:100 Identity:51/100 - (51%)
Similarity:68/100 - (68%) Gaps:3/100 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKSILVLACLLSALCLAAAAPDAEIVDLVSDVNADSYSYKFETSDGTKQEQHGSLKSLGPEEDAL 65
            ||..:||..|.:   :|.|||..|::...|:|..|:|||..||||||.:.:.|.||:.|.|.:|:
  Fly     1 MKFAIVLFALFA---VALAAPTVEVLRSDSNVGIDNYSYAVETSDGTSKSEEGVLKNAGTELEAI 62

  Fly    66 QVAGSFSFVGDDGQTHAISYVADENGFQPQGEDIP 100
            ...||||:||.||||:.::||||||||||||..:|
  Fly    63 STHGSFSYVGPDGQTYTVTYVADENGFQPQGAHLP 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AaNP_477280.1 Chitin_bind_4 37..92 CDD:278791 31/54 (57%)
Cpr65Ax1NP_001097523.1 Chitin_bind_4 34..89 CDD:278791 31/54 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466926
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27015
OrthoDB 1 1.010 - - D130920at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.