DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Aa and Lcp65Ae

DIOPT Version :9

Sequence 1:NP_477280.1 Gene:Lcp65Aa / 38709 FlyBaseID:FBgn0020645 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_788468.1 Gene:Lcp65Ae / 45018 FlyBaseID:FBgn0020640 Length:99 Species:Drosophila melanogaster


Alignment Length:100 Identity:45/100 - (45%)
Similarity:64/100 - (64%) Gaps:4/100 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKSILVLACLLSALCLAAAAPDAEIVDLVSDVNADSYSYKFETSDGTKQEQHGSLKSLGPEEDAL 65
            ||.::|..    |:...|.|.:|:|::|.|||..:::.:.||||||......|.||....:.::|
  Fly     1 MKFLIVFV----AIFAFALANEAQIINLESDVGPENFQWSFETSDGQAANAKGQLKYPNTDHESL 61

  Fly    66 QVAGSFSFVGDDGQTHAISYVADENGFQPQGEDIP 100
            .|.|||.||.|||||:.::|:||||||||||..:|
  Fly    62 AVQGSFRFVADDGQTYEVNYIADENGFQPQGAHLP 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AaNP_477280.1 Chitin_bind_4 37..92 CDD:278791 26/54 (48%)
Lcp65AeNP_788468.1 Chitin_bind_4 33..88 CDD:278791 26/54 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466896
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D130920at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.