DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Aa and Cpr65Eb

DIOPT Version :9

Sequence 1:NP_477280.1 Gene:Lcp65Aa / 38709 FlyBaseID:FBgn0020645 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_648076.3 Gene:Cpr65Eb / 38774 FlyBaseID:FBgn0035736 Length:179 Species:Drosophila melanogaster


Alignment Length:101 Identity:35/101 - (34%)
Similarity:57/101 - (56%) Gaps:12/101 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ILVLACLLSALCLAAAAPD--AEIVDLVSDVNADS--YSYKFETSDGTKQEQHGSLKSLGPEEDA 64
            ::.::.||......:.:||  |||...|:::..:.  |:|:||||:|..|::.|    :|    .
  Fly     9 LVAMSVLLGVQARPSDSPDAHAEIRSFVNELKQEDGIYNYQFETSNGIAQQEQG----VG----G 65

  Fly    65 LQVAGSFSFVGDDGQTHAISYVADENGFQPQGEDIP 100
            ...:||..:...:||...::|.|||||||||||.:|
  Fly    66 YYASGSSQYYTPEGQLIQLTYTADENGFQPQGEHLP 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AaNP_477280.1 Chitin_bind_4 37..92 CDD:278791 19/54 (35%)
Cpr65EbNP_648076.3 Chitin_bind_4 46..93 CDD:278791 19/54 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.