DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Aa and Cpr49Af

DIOPT Version :10

Sequence 1:NP_477280.1 Gene:Lcp65Aa / 38709 FlyBaseID:FBgn0020645 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_610775.1 Gene:Cpr49Af / 36352 FlyBaseID:FBgn0033729 Length:126 Species:Drosophila melanogaster


Alignment Length:101 Identity:37/101 - (36%)
Similarity:60/101 - (59%) Gaps:4/101 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKSILVLACLLSALCLAAAAPDAEIVDLVSDVNAD-SYSYKFETSDGTKQEQHGSLKSLGPEEDA 64
            ||.::::|..:.|   |:|..:.:.:...|:|..: .|.|.:|..||:|..|.|.|||:..:.:.
  Fly     1 MKYLMLIALFVVA---ASATDNDDPISQESNVEYNGKYHYHYELKDGSKATQDGVLKSVNADHNG 62

  Fly    65 LQVAGSFSFVGDDGQTHAISYVADENGFQPQGEDIP 100
            ..|.|.:|||.|||:|:.:||.|||||:...|:.:|
  Fly    63 ESVNGKYSFVADDGKTYVVSYTADENGYLAVGDHLP 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AaNP_477280.1 Chitin_bind_4 37..92 CDD:459790 26/54 (48%)
Cpr49AfNP_610775.1 Chitin_bind_4 35..90 CDD:459790 26/54 (48%)

Return to query results.
Submit another query.