DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Aa and CG15754

DIOPT Version :10

Sequence 1:NP_477280.1 Gene:Lcp65Aa / 38709 FlyBaseID:FBgn0020645 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_572894.1 Gene:CG15754 / 32307 FlyBaseID:FBgn0030492 Length:281 Species:Drosophila melanogaster


Alignment Length:99 Identity:23/99 - (23%)
Similarity:38/99 - (38%) Gaps:31/99 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LAAAAPDAEIVDLVS------DVNAD-SYSYKFETSDGTK--------QEQHGSLKS---LGPEE 62
            ||....|.|:.|..:      ::|.| ||.:.:....|.:        :||||.:..   :.|..
  Fly   170 LAGGQVDEELEDYNAWRDNFYELNEDGSYIFGYSIPHGIRRWEKGYYSEEQHGRVVEGFYVQPRH 234

  Fly    63 DALQVAGSFSFVGDDGQTHAI-SYVADENGFQPQ 95
            |:            .|..:.: .|.||..|:||:
  Fly   235 DS------------QGLRYELRCYRADSEGYQPR 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AaNP_477280.1 Chitin_bind_4 37..92 CDD:459790 12/66 (18%)
CG15754NP_572894.1 None

Return to query results.
Submit another query.