DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Aa and Cpr49Aa

DIOPT Version :10

Sequence 1:NP_477280.1 Gene:Lcp65Aa / 38709 FlyBaseID:FBgn0020645 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_001097285.1 Gene:Cpr49Aa / 246413 FlyBaseID:FBgn0050045 Length:144 Species:Drosophila melanogaster


Alignment Length:109 Identity:46/109 - (42%)
Similarity:63/109 - (57%) Gaps:14/109 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SILVLACLLSALCLAAAAPDAE---------IVDLVSDVNAD-SYSYKFETSDGTKQEQHGSLKS 57
            ::|.:|.||  |.||.|.|...         |:....:||.| ||.|.:||.:|...|:.|.||:
  Fly     4 TLLFIAALL--LSLAQARPQVRGQAPGEPIPIIRQEQEVNFDGSYKYLYETGNGINAEEEGYLKN 66

  Fly    58 LGPEEDALQVA-GSFSFVGDDGQTHAISYVADENGFQPQGEDIP 100
            .| .::|.||| ||||:...:|....|:|:||||||||||:.:|
  Fly    67 PG-TDNAGQVAQGSFSYTSPEGIPIRITYLADENGFQPQGDHLP 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AaNP_477280.1 Chitin_bind_4 37..92 CDD:459790 25/55 (45%)
Cpr49AaNP_001097285.1 Chitin_bind_4 46..101 CDD:459790 25/55 (45%)

Return to query results.
Submit another query.