DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SUMO4 and Rad60

DIOPT Version :10

Sequence 1:NP_001002255.1 Gene:SUMO4 / 387082 HGNCID:21181 Length:95 Species:Homo sapiens
Sequence 2:NP_651134.1 Gene:Rad60 / 42748 FlyBaseID:FBgn0039065 Length:424 Species:Drosophila melanogaster


Alignment Length:105 Identity:26/105 - (24%)
Similarity:41/105 - (39%) Gaps:32/105 - (30%)


- Green bases have known domain annotations that are detailed below.


Human     6 PTEEVKTENNNHINLKVAGQDGSVV----QFKIKRQT-----PLSKLMK---------------A 46
            ||   |:.|||::..|:.....::.    :|::|.|.     ||...||               .
  Fly   324 PT---KSHNNNNVAAKIDYNPEALCRKPKKFQVKVQADKWKHPLVIPMKKTDNFKIIFIKCAEEL 385

Human    47 YCEPRGLSVKQIRFRFGGQPISGTDKPAQLEMEDEDTIDV 86
            .|:||     .|:..|.|..:...|.|...:||..:.||:
  Fly   386 NCDPR-----TIKLFFDGDLLDPNDTPNNQDMEGNEVIDL 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SUMO4NP_001002255.1 Ubl_SUMO2_3_4 17..88 CDD:340532 20/94 (21%)
Rad60NP_651134.1 Ubl1_cv_Nsp3_N-like 254..315 CDD:475130
Ubl_SUMO_like 350..419 CDD:340462 17/73 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.