DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ac and LOC5667265

DIOPT Version :10

Sequence 1:NP_477279.1 Gene:Lcp65Ac / 38708 FlyBaseID:FBgn0020642 Length:109 Species:Drosophila melanogaster
Sequence 2:XP_001688121.2 Gene:LOC5667265 / 5667265 VectorBaseID:AGAMI1_009930 Length:122 Species:Anopheles gambiae


Alignment Length:82 Identity:19/82 - (23%)
Similarity:34/82 - (41%) Gaps:16/82 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SKNTNAGVKTES--------HTSSSKTGTKVILVLVGFV--AVAMFSFFLYKLWQKKKRDEQYAR 87
            :|.||  |:||:        ...:.|...::...|..|:  ..:..:.|.::.:|.:....|:..
Mosquito    37 AKRTN--VETEAAWAYGSNITDENEKKKNEISAELAKFMKEVASDTTKFQWRSYQSEDLKRQFKA 99

  Fly    88 LLKL----FEEDDELEV 100
            |.||    ..|||..|:
Mosquito   100 LTKLGYAALPEDDYAEL 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AcNP_477279.1 Chitin_bind_4 40..95 CDD:459790 12/68 (18%)
LOC5667265XP_001688121.2 None

Return to query results.
Submit another query.