DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ac and LOC4576767

DIOPT Version :10

Sequence 1:NP_477279.1 Gene:Lcp65Ac / 38708 FlyBaseID:FBgn0020642 Length:109 Species:Drosophila melanogaster
Sequence 2:XP_001237146.2 Gene:LOC4576767 / 4576767 VectorBaseID:AGAMI1_004843 Length:417 Species:Anopheles gambiae


Alignment Length:65 Identity:20/65 - (30%)
Similarity:30/65 - (46%) Gaps:6/65 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 GKKHEEQGQLKNVGTEQEAIVVRGSYSFVADDGQTYTVNYIAD-ENGFQPE-----GAHLPNVPI 107
            |.|....|..|.....::..||:|.|:....||....|:|.:| .|||:.:     .||.|:.|:
Mosquito   313 GVKDPHTGDHKTQWEVRDGDVVKGQYTLHEADGTERVVDYKSDGHNGFEADVKKVGHAHHPSHPV 377

  Fly   108  107
            Mosquito   378  377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AcNP_477279.1 Chitin_bind_4 40..95 CDD:459790 14/46 (30%)
LOC4576767XP_001237146.2 None

Return to query results.
Submit another query.