DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ac and Cpr97Eb

DIOPT Version :10

Sequence 1:NP_477279.1 Gene:Lcp65Ac / 38708 FlyBaseID:FBgn0020642 Length:109 Species:Drosophila melanogaster
Sequence 2:NP_651530.1 Gene:Cpr97Eb / 43259 FlyBaseID:FBgn0039481 Length:235 Species:Drosophila melanogaster


Alignment Length:109 Identity:27/109 - (24%)
Similarity:47/109 - (43%) Gaps:12/109 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKCTVAIVFTALFAVVLAAPAPDADTQI---LRLESDVQPEGYNFALETSDGKKHEEQGQLKNVG 62
            :|.|:::....|.|....|...|..|.:   .:::.......|.:..|.:|        :...:.
  Fly     2 LKLTLSLGLLLLAAHSAYAQHQDYTTPVPILKQIDKHNDDGSYTYGYEAAD--------KSFKIE 58

  Fly    63 TEQEAIVVRGSYSFVADDGQTYTVNYIADENGFQPEGAHLPNVP 106
            |:.....|.|.|.:|.|.|:...:.|.|.:.||:|.|:|: |||
  Fly    59 TKYANGEVYGKYGYVDDQGKVREIEYGASKRGFEPAGSHI-NVP 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AcNP_477279.1 Chitin_bind_4 40..95 CDD:459790 12/54 (22%)
Cpr97EbNP_651530.1 Chitin_bind_4 44..91 CDD:459790 12/54 (22%)

Return to query results.
Submit another query.