DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ac and Cpr92A

DIOPT Version :10

Sequence 1:NP_477279.1 Gene:Lcp65Ac / 38708 FlyBaseID:FBgn0020642 Length:109 Species:Drosophila melanogaster
Sequence 2:NP_650813.2 Gene:Cpr92A / 42333 FlyBaseID:FBgn0038714 Length:245 Species:Drosophila melanogaster


Alignment Length:79 Identity:29/79 - (36%)
Similarity:37/79 - (46%) Gaps:16/79 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 AAPAPDADTQILRLESDVQPEGYNFALETSDGKKHEEQGQLKNVGTEQEAIVVRGSYSFVADDGQ 82
            |||.|          .|..|: |:|..:..||    ..|.||:....:...||:||||.|..||.
  Fly    57 AAPEP----------YDPDPK-YSFGYDIQDG----YTGDLKSQHETRHGDVVKGSYSVVDPDGT 106

  Fly    83 TYTVNYIAD-ENGF 95
            ..||:|.|| .:||
  Fly   107 KRTVDYTADPHHGF 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AcNP_477279.1 Chitin_bind_4 40..95 CDD:459790 21/55 (38%)
Cpr92ANP_650813.2 Chitin_bind_4 68..120 CDD:459790 21/55 (38%)

Return to query results.
Submit another query.