DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ac and CG8927

DIOPT Version :10

Sequence 1:NP_477279.1 Gene:Lcp65Ac / 38708 FlyBaseID:FBgn0020642 Length:109 Species:Drosophila melanogaster
Sequence 2:NP_650527.2 Gene:CG8927 / 41964 FlyBaseID:FBgn0038405 Length:371 Species:Drosophila melanogaster


Alignment Length:98 Identity:24/98 - (24%)
Similarity:37/98 - (37%) Gaps:27/98 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 TQILRLESDVQPEG-YNFALETSDGKKHEEQGQLKNVGTEQEAIVVRGSYSFVADDGQTYTVNYI 89
            :|.:|...:...:| ..:..|..||...||.     :||:   .:.:|:|.:|..||.....:|.
  Fly   259 SQTIRKWREENEDGSITWGYENDDGSFKEEL-----IGTD---CITKGTYGYVDPDGNKREYHYE 315

  Fly    90 A---------------DENGF---QPEGAHLPN 104
            .               .||||   :...|.|||
  Fly   316 TGIKCDPNNRNNEEELQENGFVNYEENRAVLPN 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AcNP_477279.1 Chitin_bind_4 40..95 CDD:459790 15/69 (22%)
CG8927NP_650527.2 Chitin_bind_4 277..336 CDD:459790 15/66 (23%)

Return to query results.
Submit another query.