DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ac and Ccp84Af

DIOPT Version :10

Sequence 1:NP_477279.1 Gene:Lcp65Ac / 38708 FlyBaseID:FBgn0020642 Length:109 Species:Drosophila melanogaster
Sequence 2:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster


Alignment Length:104 Identity:33/104 - (31%)
Similarity:46/104 - (44%) Gaps:13/104 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VAIVFTALFAVVLAAPAPDADTQILRLESDVQPEGYNFALETSDGKKHEEQGQLKNVGTEQEAIV 69
            ||....|..||..|.|.....|:    |.|..|: |.||.:..|....:.:.|::    |::..|
  Fly    32 VATYAQAPVAVAHAQPVLTKATE----EYDPHPQ-YKFAYDVQDSLSGDSKSQVE----ERDGDV 87

  Fly    70 VRGSYSFVADDGQTYTVNYIADE-NGFQPEGAHLPNVPI 107
            |.|.||.:..||....|.|.:|. |||   .|.:..||:
  Fly    88 VHGEYSLIDSDGYKRIVQYTSDPVNGF---NAVVNRVPL 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AcNP_477279.1 Chitin_bind_4 40..95 CDD:459790 17/55 (31%)
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:459790 17/55 (31%)

Return to query results.
Submit another query.