DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ac and Cpr78E

DIOPT Version :10

Sequence 1:NP_477279.1 Gene:Lcp65Ac / 38708 FlyBaseID:FBgn0020642 Length:109 Species:Drosophila melanogaster
Sequence 2:NP_649345.1 Gene:Cpr78E / 40408 FlyBaseID:FBgn0037114 Length:137 Species:Drosophila melanogaster


Alignment Length:102 Identity:41/102 - (40%)
Similarity:57/102 - (55%) Gaps:8/102 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 AVVLAAPAP--DADTQ----ILRLESDVQPEG-YNFALETSDGKKHEEQGQLKNVGTEQEAIVVR 71
            ||||:||..  .:.||    ||....:...:| |||:....||....|:..::|.|||.|.:.:.
  Fly    14 AVVLSAPVDHVTSTTQPPVAILESSHEKHEDGSYNFSYLGEDGTHRREEAVVRNQGTENEYLEIS 78

  Fly    72 GSYSFVADDGQTYTVNYIADENGFQPE-GAHLPNVPI 107
            ||||:...:||..||.|.||::||.|| ||.||.:.:
  Fly    79 GSYSYFDANGQEVTVTYKADDHGFVPEGGAILPQISL 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AcNP_477279.1 Chitin_bind_4 40..95 CDD:459790 22/54 (41%)
Cpr78ENP_649345.1 Chitin_bind_4 47..102 CDD:459790 22/54 (41%)

Return to query results.
Submit another query.