DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ac and Cpr76Bb

DIOPT Version :10

Sequence 1:NP_477279.1 Gene:Lcp65Ac / 38708 FlyBaseID:FBgn0020642 Length:109 Species:Drosophila melanogaster
Sequence 2:NP_649121.1 Gene:Cpr76Bb / 40121 FlyBaseID:FBgn0036879 Length:198 Species:Drosophila melanogaster


Alignment Length:84 Identity:25/84 - (29%)
Similarity:33/84 - (39%) Gaps:17/84 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 GYNFALETSD-----------GKKHEEQGQLKNVGTEQEAIVVRGSYSFVADDGQTYTVNYIADE 92
            ||.:..:..:           |.|....|..|:....::...|:||||....||.|..|.|.||:
  Fly    70 GYGYGYDKHEPHHYPKYQFDYGVKDAHTGDQKSQWETRDGDKVKGSYSLKESDGTTRVVEYTADD 134

  Fly    93 -NGFQP-----EGAHLPNV 105
             |||..     ..||.|.|
  Fly   135 HNGFNAVVKKLGHAHHPQV 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AcNP_477279.1 Chitin_bind_4 40..95 CDD:459790 18/66 (27%)
Cpr76BbNP_649121.1 Chitin_bind_4 86..138 CDD:459790 17/51 (33%)

Return to query results.
Submit another query.