DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ac and Cpr65Az

DIOPT Version :10

Sequence 1:NP_477279.1 Gene:Lcp65Ac / 38708 FlyBaseID:FBgn0020642 Length:109 Species:Drosophila melanogaster
Sequence 2:NP_648031.1 Gene:Cpr65Az / 38712 FlyBaseID:FBgn0035686 Length:239 Species:Drosophila melanogaster


Alignment Length:84 Identity:42/84 - (50%)
Similarity:54/84 - (64%) Gaps:2/84 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DTQILRLESDVQPEG-YNFALETSDGKKHEEQGQLKNVGTE-QEAIVVRGSYSFVADDGQTYTVN 87
            |..|::|||.|..:| |.:..||.:|.|.||.|.|||.|.| .||....||:|:.:.:||..::.
  Fly   113 DIPIIKLESKVNTDGSYMYEYETGNGIKAEEMGYLKNAGVEGAEAQTAEGSFSYTSPEGQEISLT 177

  Fly    88 YIADENGFQPEGAHLPNVP 106
            ||||||||||:|.|||..|
  Fly   178 YIADENGFQPQGDHLPTPP 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AcNP_477279.1 Chitin_bind_4 40..95 CDD:459790 26/55 (47%)
Cpr65AzNP_648031.1 Chitin_bind_4 129..185 CDD:459790 26/55 (47%)

Return to query results.
Submit another query.