DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ac and Acp65Aa

DIOPT Version :10

Sequence 1:NP_477279.1 Gene:Lcp65Ac / 38708 FlyBaseID:FBgn0020642 Length:109 Species:Drosophila melanogaster
Sequence 2:NP_477282.2 Gene:Acp65Aa / 38710 FlyBaseID:FBgn0020765 Length:105 Species:Drosophila melanogaster


Alignment Length:104 Identity:50/104 - (48%)
Similarity:69/104 - (66%) Gaps:2/104 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKCTVAIVFTALFAVVLAAPAPDADTQILRLESD-VQPEGYNFALETSDGKKHEEQGQLKNVGTE 64
            ||..:.:...||. :.||:..|..|.::|..||: ....||.|:.:.|||....|:|.:.|.||:
  Fly     2 MKLMLVVGSIALL-LALASARPQNDVEVLEYESENTGLGGYKFSYKLSDGTSRTEEGVVNNAGTD 65

  Fly    65 QEAIVVRGSYSFVADDGQTYTVNYIADENGFQPEGAHLP 103
            .|:|.:|||.::||.||||||:|::||||||||||||||
  Fly    66 NESISIRGSVTWVAPDGQTYTINFVADENGFQPEGAHLP 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AcNP_477279.1 Chitin_bind_4 40..95 CDD:459790 28/54 (52%)
Acp65AaNP_477282.2 Chitin_bind_4 41..96 CDD:459790 28/54 (52%)

Return to query results.
Submit another query.