DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ac and l(3)mbn

DIOPT Version :10

Sequence 1:NP_477279.1 Gene:Lcp65Ac / 38708 FlyBaseID:FBgn0020642 Length:109 Species:Drosophila melanogaster
Sequence 2:NP_729143.2 Gene:l(3)mbn / 38701 FlyBaseID:FBgn0002440 Length:653 Species:Drosophila melanogaster


Alignment Length:50 Identity:21/50 - (42%)
Similarity:27/50 - (54%) Gaps:8/50 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 DGKKHEEQGQLKNVGTEQEAIVVRGSYSFVADDGQTYTVNYIADENGFQP 97
            |...|||.|. :| |.:|      |||..:.:|....|:.|||:|.||||
  Fly   582 DYNGHEETGG-RN-GDKQ------GSYFAIGEDAVQRTIEYIANEFGFQP 623

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AcNP_477279.1 Chitin_bind_4 40..95 CDD:459790 17/46 (37%)
l(3)mbnNP_729143.2 Chitin_bind_4 575..621 CDD:459790 17/46 (37%)

Return to query results.
Submit another query.