DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ac and Cpr49Ag

DIOPT Version :9

Sequence 1:NP_477279.1 Gene:Lcp65Ac / 38708 FlyBaseID:FBgn0020642 Length:109 Species:Drosophila melanogaster
Sequence 2:NP_610776.1 Gene:Cpr49Ag / 36353 FlyBaseID:FBgn0033730 Length:134 Species:Drosophila melanogaster


Alignment Length:131 Identity:46/131 - (35%)
Similarity:65/131 - (49%) Gaps:26/131 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KCTVAIVFTALFAVVLAAP------APDADT-----QILRLESDVQPEG-YNFALETSDGKKHEE 54
            |....:....|.:.|||.|      |..|.|     .|::.::....:| :|.:.|||:|.:.|.
  Fly     3 KLVFLVCSALLLSYVLARPQDQRAGATSAATTTTAATIVKQDNVNNADGSFNSSYETSNGIRVEN 67

  Fly    55 QGQLKNV---GTE----------QEAIVVR-GSYSFVADDGQTYTVNYIADENGFQPEGAHLPNV 105
            .|.||.:   .||          :|.::|: ||||:...||...|:.|:||||||||||.|||..
  Fly    68 IGYLKKIIVPKTETSDGQVIDEHEELVLVQTGSYSYSDPDGNLITLRYVADENGFQPEGDHLPVA 132

  Fly   106 P 106
            |
  Fly   133 P 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AcNP_477279.1 Chitin_bind_4 40..95 CDD:278791 25/68 (37%)
Cpr49AgNP_610776.1 Chitin_bind_4 53..122 CDD:278791 25/68 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.