DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ac and Cpr11B

DIOPT Version :9

Sequence 1:NP_477279.1 Gene:Lcp65Ac / 38708 FlyBaseID:FBgn0020642 Length:109 Species:Drosophila melanogaster
Sequence 2:NP_572807.1 Gene:Cpr11B / 32203 FlyBaseID:FBgn0030398 Length:197 Species:Drosophila melanogaster


Alignment Length:145 Identity:46/145 - (31%)
Similarity:62/145 - (42%) Gaps:43/145 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TVAIVFTALFAVVLAA-------PAPDA--------------------------------DTQIL 29
            |||:|.....:.:||.       |.|.|                                ..||.
  Fly     7 TVALVLFGFSSAILAGRLSQRYLPTPQASQLHYHGVSGQGQARPGAGHSFGGGSSYQRQQQPQIP 71

  Fly    30 RLESDVQPE---GYNFALETSDGKKHEEQGQLKNVGTEQEAIVVRGSYSFVADDGQTYTVNYIAD 91
            .:.||...:   .|||..:|.:|...:|.|:.:. |....::.|:||||:..|||:.|||||.||
  Fly    72 IVRSDYNSDANGNYNFGFDTGNGIHRDETGEFRG-GWPHGSLGVQGSYSYTGDDGKQYTVNYTAD 135

  Fly    92 ENGFQPEGAHLPNVP 106
            :|||..||||||..|
  Fly   136 KNGFHAEGAHLPVSP 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AcNP_477279.1 Chitin_bind_4 40..95 CDD:278791 24/54 (44%)
Cpr11BNP_572807.1 Chitin_bind_4 85..139 CDD:278791 24/54 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1508073at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.