DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ac and Cpr31A

DIOPT Version :10

Sequence 1:NP_477279.1 Gene:Lcp65Ac / 38708 FlyBaseID:FBgn0020642 Length:109 Species:Drosophila melanogaster
Sequence 2:NP_995678.1 Gene:Cpr31A / 2768918 FlyBaseID:FBgn0053302 Length:340 Species:Drosophila melanogaster


Alignment Length:136 Identity:37/136 - (27%)
Similarity:52/136 - (38%) Gaps:41/136 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IVFTALFAVVLAAP-------APDADTQILRLESDVQPEGYNFALETSDGKKHEEQGQLKNVGTE 64
            :|.|...|.|:|||       ||....|: .|||..:   |:|    |.|......|.:|:....
  Fly    99 VVKTLAAAPVVAAPVVKTVAAAPAVLKQV-ELESSPR---YDF----SYGVHDSITGDIKSQVET 155

  Fly    65 QEAIVVRGSYSFVADDGQTYTVNYIADE-NGFQ-------------------------PEGAHLP 103
            ::...|.||||.:..||...||.|.||: |||.                         |...|:.
  Fly   156 RDGGNVVGSYSVLDADGFKRTVTYTADDINGFNAVVQREPVVAARAVAAPVVSVSAPAPVPVHIS 220

  Fly   104 NVPIGN 109
            :.|:.:
  Fly   221 SAPVAS 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AcNP_477279.1 Chitin_bind_4 40..95 CDD:459790 19/55 (35%)
Cpr31ANP_995678.1 Chitin_bind_4 135..187 CDD:459790 19/55 (35%)

Return to query results.
Submit another query.